Cytochrome C1 Antikörper (Middle Region)

Produktnummer ABIN631089

Produktdetails anti-Cytochrome C1 Antikörper

Target: Cytochrome C1 (CYC1)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cytochrome C1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYC1 antibody was raised against the middle region of CYC1

Aufreinigung: Affinity purified

Immunogen: CYC1 antibody was raised using the middle region of CYC1 corresponding to a region with amino acids RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYC1 Blocking Peptide, catalog no. 33R-8262, is also available for use as a blocking control in assays to test for specificity of this CYC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cytochrome C1

Target: Cytochrome C1 (CYC1)

Andere Bezeichnung: CYC1 (CYC1 Produkte)

Synonyme: DDBDRAFT_0184465 antikoerper, DDBDRAFT_0238603 antikoerper, DDB_0184465 antikoerper, DDB_0238603 antikoerper, UQCR4 antikoerper, 2610002H19Rik antikoerper, AA408921 antikoerper, fb80h03 antikoerper, im:6911272 antikoerper, sr:nyz104 antikoerper, wu:fb80h03 antikoerper, zgc:123089 antikoerper, cytochrome c1 antikoerper, cytochrome c-1 antikoerper, cytochrome c-1 L homeolog antikoerper, Sputw3181_0667 antikoerper, Shal_3628 antikoerper, Mpop_2472 antikoerper, Hneap_1140 antikoerper, cyc1 antikoerper, Bresu_2679 antikoerper, Fbal_3419 antikoerper, Sulku_2312 antikoerper, LOC100127128 antikoerper, ZMO0958 antikoerper, Rsph17029_0061 antikoerper, Mesop_2273 antikoerper, CYC1 antikoerper, Cyc1 antikoerper, cyc1.L antikoerper

Hintergrund: CYC1 is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.

Molekulargewicht: 35 kDa (MW of target protein)