MTO1 Antikörper
-
- Target Alle MTO1 Produkte
- MTO1
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MTO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTO1 Blocking Peptide, catalog no. 33R-8897, is also available for use as a blocking control in assays to test for specificity of this MTO1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTO1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTO1
- Abstract
- MTO1 Produkte
- Synonyme
- 2310039H01Rik antikoerper, 5730419A02Rik antikoerper, COXPD10 antikoerper, mitochondrial tRNA translation optimization 1 antikoerper, Mto1 antikoerper, MTO1 antikoerper
- Hintergrund
- MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.
- Molekulargewicht
- 81 kDa (MW of target protein)
-