MTO1 Antikörper

Produktnummer ABIN631087

Produktdetails anti-MTO1 Antikörper

Target: MTO1

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MTO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTO1 Blocking Peptide, catalog no. 33R-8897, is also available for use as a blocking control in assays to test for specificity of this MTO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTO1

Target: MTO1

Abstract: MTO1 Produkte

Synonyme: 2310039H01Rik antikoerper, 5730419A02Rik antikoerper, COXPD10 antikoerper, mitochondrial tRNA translation optimization 1 antikoerper, Mto1 antikoerper, MTO1 antikoerper

Hintergrund: MTO1 is a mitochondrial protein thought to be involved in mitochondrial tRNA modification. It may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene.

Molekulargewicht: 81 kDa (MW of target protein)