NDUFA9 Antikörper

Produktnummer ABIN631081

Produktdetails anti-NDUFA9 Antikörper

Target: NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDUFA9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDUFA9 Blocking Peptide, catalog no. 33R-7627, is also available for use as a blocking control in assays to test for specificity of this NDUFA9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFA9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDUFA9

Target: NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))

Andere Bezeichnung: NDUFA9 (NDUFA9 Produkte)

Synonyme: ndufs2l antikoerper, wu:fc41f12 antikoerper, zgc:112513 antikoerper, GB10406 antikoerper, NDUFA9 antikoerper, DDBDRAFT_0203708 antikoerper, DDBDRAFT_0302549 antikoerper, DDB_0203708 antikoerper, DDB_0302549 antikoerper, 1010001N11Rik antikoerper, CC6 antikoerper, CI-39k antikoerper, CI39k antikoerper, NDUFS2L antikoerper, SDR22E1 antikoerper, NADH:ubiquinone oxidoreductase subunit A9 antikoerper, NADH:ubiquinone oxidoreductase subunit A9 L homeolog antikoerper, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9a antikoerper, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial antikoerper, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 antikoerper, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa antikoerper, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 antikoerper, NDUFA9 antikoerper, ndufa9.L antikoerper, ndufa9 antikoerper, ndufa9a antikoerper, LOC551866 antikoerper, Ndufa9 antikoerper

Hintergrund: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane.

Molekulargewicht: 42 kDa (MW of target protein)