NDUFC1 Antikörper
-
- Target Alle NDUFC1 Antikörper anzeigen
- NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDUFC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL
- Top Product
- Discover our top product NDUFC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NDUFC1 Blocking Peptide, catalog no. 33R-8188, is also available for use as a blocking control in assays to test for specificity of this NDUFC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))
- Andere Bezeichnung
- NDUFC1 (NDUFC1 Produkte)
- Synonyme
- 2310016K22Rik antikoerper, KFYI antikoerper, CI-KFYI antikoerper, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1 antikoerper, NADH:ubiquinone oxidoreductase subunit C1 antikoerper, Ndufc1 antikoerper, NDUFC1 antikoerper
- Hintergrund
- NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain.
- Molekulargewicht
- 9 kDa (MW of target protein)
-