ATP6V1B2 Antikörper (N-Term)

Produktnummer ABIN631079

Produktdetails anti-ATP6V1B2 Antikörper

Target: ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6V1B2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP6 V6 2 antibody was raised against the N terminal of ATP6 6 2

Aufreinigung: Affinity purified

Immunogen: ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6V1B2 Blocking Peptide, catalog no. 33R-9821, is also available for use as a blocking control in assays to test for specificity of this ATP6V1B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6V1B2

Target: ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))

Andere Bezeichnung: ATP6V1B2 (ATP6V1B2 Produkte)

Synonyme: Atp6b1b2 antikoerper, Atp6b2 antikoerper, Vatb antikoerper, vha55 antikoerper, VATB antikoerper, ATP6B1B2 antikoerper, ATP6B2 antikoerper, HO57 antikoerper, VPP3 antikoerper, Vma2 antikoerper, atp6v1bb antikoerper, fj51e01 antikoerper, vatB2 antikoerper, wu:fj51e01 antikoerper, zgc:109771 antikoerper, AI194269 antikoerper, AI790362 antikoerper, R74844 antikoerper, ATPase H+ transporting V1 subunit B2 antikoerper, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2 S homeolog antikoerper, ATPase, H+ transporting, lysosomal, V1 subunit B2 antikoerper, ATPase, H+ transporting, lysosomal V1 subunit B2 antikoerper, Atp6v1b2 antikoerper, atp6v1b2.S antikoerper, ATP6V1B2 antikoerper, atp6v1b2 antikoerper

Hintergrund: ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport