ETFA Antikörper
-
- Target Alle ETFA Antikörper anzeigen
- ETFA (Electron-Transfer-Flavoprotein, alpha Polypeptide (ETFA))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ETFA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ETFA antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG
- Top Product
- Discover our top product ETFA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ETFA Blocking Peptide, catalog no. 33R-9895, is also available for use as a blocking control in assays to test for specificity of this ETFA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ETFA (Electron-Transfer-Flavoprotein, alpha Polypeptide (ETFA))
- Andere Bezeichnung
- ETFA (ETFA Produkte)
- Synonyme
- 2010200I21Rik antikoerper, D9Ertd394e antikoerper, ETF antikoerper, EMA antikoerper, GA2 antikoerper, MADD antikoerper, cb1020 antikoerper, fd06h11 antikoerper, wu:fd06h11 antikoerper, ema antikoerper, ga2 antikoerper, madd antikoerper, electron transfer flavoprotein alpha subunit antikoerper, electron-transfer-flavoprotein, alpha polypeptide antikoerper, putative electron-transfer-flavoprotein,alpha polypeptide antikoerper, electron transfer flavoprotein subunit alpha, mitochondrial antikoerper, electron transferring flavoprotein, alpha polypeptide antikoerper, electron transfer flavoprotein alpha subunit L homeolog antikoerper, ETFA antikoerper, Tc00.1047053503559.109 antikoerper, Tc00.1047053511693.90 antikoerper, LMJF_28_1140 antikoerper, LOC100194695 antikoerper, etfa antikoerper, Etfa antikoerper, etfa.L antikoerper
- Hintergrund
- ETFA participates in catalyzing the initial step of the mitochondrial fatty acid beta-oxidation. It shuttles electrons between primary flavoprotein dehydrogenases and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. Defects in electron-transfer-flavoprotein have been implicated in type II glutaricaciduria in which multiple acyl-CoA dehydrogenase deficiencies result in large excretion of glutaric, lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-