Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial (N-Term) Antikörper

Produktnummer ABIN631056

Produktdetails

Target: Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACADM antibody was raised against the N terminal of ACADM

Aufreinigung: Affinity purified

Immunogen: ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACADM Blocking Peptide, catalog no. 33R-1020, is also available for use as a blocking control in assays to test for specificity of this ACADM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Medium-Chain Specific Acyl-CoA Dehydrogenase, Mitochondrial

Andere Bezeichnung: ACADM

Synonyme: ACAD1 antikoerper, MCAD antikoerper, MCADH antikoerper, AU018656 antikoerper, acyl-CoA dehydrogenase medium chain antikoerper, acyl-Coenzyme A dehydrogenase, medium chain antikoerper, acyl-CoA dehydrogenase, C-4 to C-12 straight chain antikoerper, ACADM antikoerper, Acadm antikoerper

Hintergrund: ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.

Molekulargewicht: 46 kDa (MW of target protein)