TMLHE Antikörper (Middle Region)

Produktnummer ABIN631052

Der Kaninchen Polyklonal anti-TMLHE Antikörper wird verwendet zum Nachweis von TMLHE in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TMLHE Antikörper (Middle Region) (ABIN631052)

Target: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMLHE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMLHE Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMLHE antibody was raised against the middle region of TMLHE

Aufreinigung: Affinity purified

Immunogen: TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMLHE Blocking Peptide, (ABIN5616693), is also available for use as a blocking control in assays to test for specificity of this TMLHE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMLHE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMLHE

Target: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Andere Bezeichnung: TMLHE

Hintergrund: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane.

Molekulargewicht: 49 kDa (MW of target protein)