TMLHE Antikörper (Middle Region)

Produktnummer ABIN631052

Produktdetails anti-TMLHE Antikörper

Target: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMLHE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMLHE antibody was raised against the middle region of TMLHE

Aufreinigung: Affinity purified

Immunogen: TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMLHE Blocking Peptide, catalog no. 33R-7434, is also available for use as a blocking control in assays to test for specificity of this TMLHE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMLHE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMLHE

Target: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Andere Bezeichnung: TMLHE (TMLHE Produkte)

Synonyme: AUTSX6 antikoerper, BBOX2 antikoerper, TMLD antikoerper, TMLH antikoerper, TMLHED antikoerper, XAP130 antikoerper, Bbox2 antikoerper, D430017M14Rik antikoerper, Tmlh antikoerper, trimethyllysine dioxygenase, mitochondrial antikoerper, trimethyllysine hydroxylase, epsilon antikoerper, trimethyllysine hydroxylase, epsilon L homeolog antikoerper, LOC465953 antikoerper, TMLHE antikoerper, tmlhe antikoerper, tmlhe.L antikoerper, Tmlhe antikoerper

Hintergrund: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane.

Molekulargewicht: 49 kDa (MW of target protein)