MPP5 Antikörper

Produktnummer ABIN631051

Produktdetails anti-MPP5 Antikörper

Target: MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPP5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPP5 Blocking Peptide, catalog no. 33R-1585, is also available for use as a blocking control in assays to test for specificity of this MPP5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPP5

Target: MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))

Andere Bezeichnung: MPP5 (MPP5 Produkte)

Synonyme: PALS1 antikoerper, 3830420B02Rik antikoerper, AI255216 antikoerper, AI644496 antikoerper, Pals1 antikoerper, mpp5 antikoerper, nok antikoerper, MAGUK p55 subfamily member 5 antikoerper, membrane palmitoylated protein 5 antikoerper, membrane protein, palmitoylated 5 L homeolog antikoerper, membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) antikoerper, membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5) antikoerper, Tsp_03061 antikoerper, MPP5 antikoerper, mpp5.L antikoerper, Mpp5 antikoerper, mpp5a antikoerper

Hintergrund: Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like, based on their size and the presence of additional domains. MPP5 is a member of the p55-like MAGUK subfamily.

Molekulargewicht: 77 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Tube Formation, Asymmetric Protein Localization