HIBADH Antikörper (Middle Region)

Produktnummer ABIN631048

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HIBADH in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für HIBADH Antikörper (Middle Region) (ABIN631048)

Target: HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HIBADH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HIBADH Antikörper

Bindungsspezifität: Middle Region

Spezifität: HIBADH antibody was raised against the middle region of HIBADH

Aufreinigung: Affinity purified

Immunogen: HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HIBADH Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HIBADH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIBADH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HIBADH

Target: HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))

Andere Bezeichnung: HIBADH

Hintergrund: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.

Molekulargewicht: 35 kDa (MW of target protein)