HIBADH Antikörper (Middle Region)
-
- Target Alle HIBADH Antikörper anzeigen
- HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HIBADH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HIBADH antibody was raised against the middle region of HIBADH
- Aufreinigung
- Affinity purified
- Immunogen
- HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG
- Top Product
- Discover our top product HIBADH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HIBADH Blocking Peptide, catalog no. 33R-1292, is also available for use as a blocking control in assays to test for specificity of this HIBADH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIBADH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HIBADH (3-hydroxyisobutyrate Dehydrogenase (HIBADH))
- Andere Bezeichnung
- HIBADH (HIBADH Produkte)
- Synonyme
- NS5ATP1 antikoerper, 6430402H10Rik antikoerper, AI265272 antikoerper, hibadh antikoerper, zgc:66262 antikoerper, wu:fb07f02 antikoerper, zgc:100804 antikoerper, 3-hydroxyisobutyrate dehydrogenase antikoerper, 3-hydroxyisobutyrate dehydrogenase b antikoerper, 3-hydroxyisobutyrate dehydrogenase S homeolog antikoerper, 3-hydroxyisobutyrate dehydrogenase a antikoerper, HIBADH antikoerper, Hibadh antikoerper, hibadhb antikoerper, hibadh.S antikoerper, hibadha antikoerper
- Hintergrund
- 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.
- Molekulargewicht
- 35 kDa (MW of target protein)
-