DBNL Antikörper (Middle Region)

Produktnummer ABIN631047

Der Kaninchen Polyklonal anti-DBNL Antikörper (ABIN631047) detektiert spezifisch DBNL in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für DBNL Antikörper (Middle Region) (ABIN631047)

Target: DBNL (Drebrin-Like (DBNL))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DBNL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DBNL Antikörper

Bindungsspezifität: Middle Region

Spezifität: DBNL antibody was raised against the middle region of DBNL

Aufreinigung: Affinity purified

Immunogen: DBNL antibody was raised using the middle region of DBNL corresponding to a region with amino acids QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DBNL Blocking Peptide, (ABIN5613128), is also available for use as a blocking control in assays to test for specificity of this DBNL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBNL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DBNL

Target: DBNL (Drebrin-Like (DBNL))

Andere Bezeichnung: DBNL

Hintergrund: DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Regulation of Actin Filament Polymerization