DBNL Antikörper (Middle Region)
-
- Target Alle DBNL Antikörper anzeigen
- DBNL (Drebrin-Like (DBNL))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DBNL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DBNL antibody was raised against the middle region of DBNL
- Aufreinigung
- Affinity purified
- Immunogen
- DBNL antibody was raised using the middle region of DBNL corresponding to a region with amino acids QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE
- Top Product
- Discover our top product DBNL Primärantikörper
-
anti-Drebrin-Like (DBNL) (N-Term) antibody
DBNL Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Drebrin-Like (DBNL) (N-Term) antibodyVerified DBNL Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Drebrin-Like (DBNL) (AA 201-300) antibodyDBNL Reaktivität: Maus WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Drebrin-Like (DBNL) (AA 251-300) antibodyDBNL Reaktivität: Human, Maus, Meerschweinchen, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DBNL Blocking Peptide, catalog no. 33R-7539, is also available for use as a blocking control in assays to test for specificity of this DBNL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBNL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DBNL (Drebrin-Like (DBNL))
- Andere Bezeichnung
- DBNL (DBNL Produkte)
- Synonyme
- ABP1 antikoerper, HIP-55 antikoerper, HIP55 antikoerper, SH3P7 antikoerper, Abp1 antikoerper, mAbp1 antikoerper, Sh3p7 antikoerper, abp1 antikoerper, dbnl-B antikoerper, DBNL antikoerper, DKFZp459C0939 antikoerper, drebrin like antikoerper, drebrin-like antikoerper, drebrin like S homeolog antikoerper, drebrin 1 antikoerper, DBNL antikoerper, Dbnl antikoerper, dbnl.S antikoerper, LOC100148204 antikoerper, DBN1 antikoerper
- Hintergrund
- DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- T-Zell Rezeptor Signalweg, Regulation of Actin Filament Polymerization
-
