MMADHC Antikörper (Middle Region)
-
- Target Alle MMADHC Antikörper anzeigen
- MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMADHC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C2 ORF25 antibody was raised against the middle region of C2 rf25
- Aufreinigung
- Affinity purified
- Immunogen
- C2 ORF25 antibody was raised using the middle region of C2 rf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI
- Top Product
- Discover our top product MMADHC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C2ORF25 Blocking Peptide, catalog no. 33R-7803, is also available for use as a blocking control in assays to test for specificity of this C2ORF25 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))
- Andere Bezeichnung
- C2ORF25 (MMADHC Produkte)
- Synonyme
- C2orf25 antikoerper, CL25022 antikoerper, cblD antikoerper, 2010311D03Rik antikoerper, AI314967 antikoerper, RGD1303272 antikoerper, methylmalonic aciduria and homocystinuria, cblD type antikoerper, methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria antikoerper, MMADHC antikoerper, Mmadhc antikoerper
- Hintergrund
- Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism.
- Molekulargewicht
- 33 kDa (MW of target protein)
-