CYP27A1 Antikörper (Middle Region)
-
- Target Alle CYP27A1 Antikörper anzeigen
- CYP27A1 (Cytochrome P450, Family 27, Subfamily A, Polypeptide 1 (CYP27A1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYP27A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYP27 A1 antibody was raised against the middle region of CYP27 1
- Aufreinigung
- Affinity purified
- Immunogen
- CYP27 A1 antibody was raised using the middle region of CYP27 1 corresponding to a region with amino acids SRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRI
- Top Product
- Discover our top product CYP27A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYP27A1 Blocking Peptide, catalog no. 33R-8744, is also available for use as a blocking control in assays to test for specificity of this CYP27A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP27A1 (Cytochrome P450, Family 27, Subfamily A, Polypeptide 1 (CYP27A1))
- Andere Bezeichnung
- CYP27A1 (CYP27A1 Produkte)
- Synonyme
- CP27 antikoerper, CTX antikoerper, CYP27 antikoerper, Cyp27 antikoerper, P450C27 antikoerper, 1300013A03Rik antikoerper, cytochrome P450 family 27 subfamily A member 1 antikoerper, cytochrome P450, family 27, subfamily a, polypeptide 1 antikoerper, cytochrome P450, family 27, subfamily A, polypeptide 1 antikoerper, sterol 26-hydroxylase, mitochondrial antikoerper, CYP27A1 antikoerper, Cyp27a1 antikoerper, cyp27a1 antikoerper
- Hintergrund
- CYP27A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.
- Molekulargewicht
- 57 kDa (MW of target protein)
-