PPM1K Antikörper
-
- Target Alle PPM1K Antikörper anzeigen
- PPM1K (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPM1K Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPM1 K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA
- Top Product
- Discover our top product PPM1K Primärantikörper
-
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 30-372) antibody
PPM1K Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) antibodyPPM1K Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) antibodyPPM1K Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (Internal Region) antibodyPPM1K Reaktivität: Human, Maus WB, ELISA, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 1-372) antibodyPPM1K Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 183-372) antibodyPPM1K Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (C-Term) antibodyPPM1K Reaktivität: Human, Maus, Ratte, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) antibodyPPM1K Reaktivität: Human, Maus, Rind (Kuh) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 205-254) antibodyPPM1K Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) (AA 1-324), (N-Term) antibodyPPM1K Reaktivität: Human, Maus, Rind (Kuh) WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPM1K Blocking Peptide, catalog no. 33R-1241, is also available for use as a blocking control in assays to test for specificity of this PPM1K antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPM1K (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K))
- Andere Bezeichnung
- PPM1K (PPM1K Produkte)
- Synonyme
- 2900063A19Rik antikoerper, A930026L03Rik antikoerper, PP2Cm antikoerper, im:6912645 antikoerper, zgc:113207 antikoerper, BDP antikoerper, MSUDMV antikoerper, PP2Ckappa antikoerper, PTMP antikoerper, UG0882E07 antikoerper, RGD1308501 antikoerper, protein phosphatase 1K (PP2C domain containing) antikoerper, protein phosphatase, Mg2+/Mn2+ dependent, 1K antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1K antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1K S homeolog antikoerper, Ppm1k antikoerper, ppm1k antikoerper, PPM1K antikoerper, ppm1k.S antikoerper
- Hintergrund
- PPM1K regulates the mitochondrial permeability transition pore and is essential for cellular survival and development.
- Molekulargewicht
- 41 kDa (MW of target protein)
-
