GPX4 Antikörper

Produktnummer ABIN631020

Produktdetails anti-GPX4 Antikörper

Target: GPX4 (Glutathione Peroxidase 4 (GPX4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPX4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GPX4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPX4 Blocking Peptide, catalog no. 33R-7765, is also available for use as a blocking control in assays to test for specificity of this GPX4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPX4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPX4

Target: GPX4 (Glutathione Peroxidase 4 (GPX4))

Andere Bezeichnung: GPX4 (GPX4 Produkte)

Synonyme: GPx-4 antikoerper, GSHPx-4 antikoerper, MCSP antikoerper, PHGPx antikoerper, snGPx antikoerper, snPHGPx antikoerper, Phgpx antikoerper, gpx-4 antikoerper, snGpx antikoerper, cb563 antikoerper, cb691 antikoerper, PHGPxa antikoerper, sb:cb563 antikoerper, zgc:92253 antikoerper, wu:fb82e03 antikoerper, 1700027O09Rik antikoerper, mtPHGPx antikoerper, ATGPX4 antikoerper, F11L15.5 antikoerper, glutathione peroxidase 4 antikoerper, GP-GPx4 antikoerper, glutathione peroxidase 4 antikoerper, glutathione peroxidase 4a antikoerper, GPX4 antikoerper, Gpx4 antikoerper, gpx4a antikoerper

Hintergrund: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Molekulargewicht: 22 kDa (MW of target protein)