TXN2 Antikörper (Middle Region)

Produktnummer ABIN631005

Der Kaninchen Polyklonal anti-TXN2 Antikörper (ABIN631005) detektiert spezifisch TXN2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für TXN2 Antikörper (Middle Region) (ABIN631005)

Target: TXN2 (Thioredoxin 2 (TXN2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TXN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TXN2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Thioredoxin 2 antibody was raised against the middle region of TXN2

Aufreinigung: Affinity purified

Immunogen: Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Thioredoxin 2 Blocking Peptide, (ABIN5616585), is also available for use as a blocking control in assays to test for specificity of this Thioredoxin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TXN2

Target: TXN2 (Thioredoxin 2 (TXN2))

Andere Bezeichnung: Thioredoxin 2

Hintergrund: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.

Molekulargewicht: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis