TXN2 Antikörper (Middle Region)
-
- Target Alle TXN2 Antikörper anzeigen
- TXN2 (Thioredoxin 2 (TXN2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TXN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Thioredoxin 2 antibody was raised against the middle region of TXN2
- Aufreinigung
- Affinity purified
- Immunogen
- Thioredoxin 2 antibody was raised using the middle region of TXN2 corresponding to a region with amino acids QHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQ
- Top Product
- Discover our top product TXN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Thioredoxin 2 Blocking Peptide, catalog no. 33R-7579, is also available for use as a blocking control in assays to test for specificity of this Thioredoxin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TXN2 (Thioredoxin 2 (TXN2))
- Andere Bezeichnung
- Thioredoxin 2 (TXN2 Produkte)
- Synonyme
- MT-TRX antikoerper, MTRX antikoerper, TRX2 antikoerper, 31884 antikoerper, CG31884 antikoerper, CG3864 antikoerper, DTrx-2 antikoerper, DmTrx-2 antikoerper, DmelTrx-2 antikoerper, Dmel\\CG31884 antikoerper, Trx antikoerper, anon-WO0118547.188 antikoerper, dmtrx-2 antikoerper, 2510006J11Rik antikoerper, AI788873 antikoerper, Trx2 antikoerper, zgc:77127 antikoerper, thioredoxin 2 antikoerper, thioredoxin-2 antikoerper, thiol reductase thioredoxin antikoerper, thioredoxin 2 L homeolog antikoerper, TXN2 antikoerper, Trx-2 antikoerper, LOC409451 antikoerper, VPA0972 antikoerper, VS_RS18125 antikoerper, VCD_000568 antikoerper, VEA_000083 antikoerper, trx2 antikoerper, Txn2 antikoerper, txn2 antikoerper, txn2.L antikoerper
- Hintergrund
- TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.
- Molekulargewicht
- 12 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-