MRPS2 Antikörper (N-Term)

Produktnummer ABIN630996

Produktdetails anti-MRPS2 Antikörper

Target: MRPS2 (Mitochondrial Ribosomal Protein S2 (MRPS2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRPS2 antibody was raised against the N terminal of MRPS2

Aufreinigung: Affinity purified

Immunogen: MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPS2 Blocking Peptide, catalog no. 33R-5791, is also available for use as a blocking control in assays to test for specificity of this MRPS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPS2

Target: MRPS2 (Mitochondrial Ribosomal Protein S2 (MRPS2))

Andere Bezeichnung: MRPS2 (MRPS2 Produkte)

Synonyme: MRP-S2 antikoerper, S2mt antikoerper, 1500019M10Rik antikoerper, mitochondrial ribosomal protein S2 antikoerper, Mrps2 antikoerper, MRPS2 antikoerper

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom