TBC1D1 Antikörper

Produktnummer ABIN630988

Produktdetails anti-TBC1D1 Antikörper

Target: TBC1D1 (TBC1 (Tre-2/USP6, BUB2, Cdc16) Domain Family, Member 1 (TBC1D1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBC1D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TBC1 D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D1 Blocking Peptide, catalog no. 33R-7942, is also available for use as a blocking control in assays to test for specificity of this TBC1D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBC1D1

Target: TBC1D1 (TBC1 (Tre-2/USP6, BUB2, Cdc16) Domain Family, Member 1 (TBC1D1))

Andere Bezeichnung: TBC1D1 (TBC1D1 Produkte)

Synonyme: TBC1D1 antikoerper, TBC antikoerper, TBC1 antikoerper, 1110062G02Rik antikoerper, AI385682 antikoerper, AW555803 antikoerper, Tbc1 antikoerper, mKIAA1108 antikoerper, TBC1 domain family member 1 antikoerper, TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1 antikoerper, TBC1 domain family, member 1 antikoerper, TBC1D1 antikoerper, tbc1d1 antikoerper, LOC100523386 antikoerper, Tbc1d1 antikoerper

Hintergrund: TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.

Molekulargewicht: 133 kDa (MW of target protein)