NDUFV3 Antikörper
-
- Target Alle NDUFV3 Antikörper anzeigen
- NDUFV3 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 3, 10kDa (NDUFV3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDUFV3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NDUFV3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR
- Top Product
- Discover our top product NDUFV3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NDUFV3 Blocking Peptide, catalog no. 33R-6975, is also available for use as a blocking control in assays to test for specificity of this NDUFV3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFV3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFV3 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 3, 10kDa (NDUFV3))
- Andere Bezeichnung
- NDUFV3 (NDUFV3 Produkte)
- Synonyme
- CI-10k antikoerper, CI-9KD antikoerper, Mipp65 antikoerper, Ndufv3l antikoerper, 1500032D16Rik antikoerper, wu:fl83h06 antikoerper, NADH:ubiquinone oxidoreductase subunit V3 antikoerper, NADH dehydrogenase (ubiquinone) flavoprotein 3 antikoerper, NDUFV3 antikoerper, Ndufv3 antikoerper, ndufv3 antikoerper
- Hintergrund
- The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and
- Molekulargewicht
- 47 kDa (MW of target protein)
-