PARD6B Antikörper

Produktnummer ABIN630967

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PARD6B in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für PARD6B Antikörper (ABIN630967)

Target: PARD6B (Par-6 Partitioning Defective 6 Homolog beta (PARD6B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARD6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PARD6B Antikörper

Aufreinigung: Affinity purified

Immunogen: PARD6 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARD6B Blocking Peptide, (ABIN5615218), is also available for use as a blocking control in assays to test for specificity of this PARD6B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARD6B

Target: PARD6B (Par-6 Partitioning Defective 6 Homolog beta (PARD6B))

Andere Bezeichnung: PARD6B

Hintergrund: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization