PARD6B Antikörper
-
- Target Alle PARD6B Antikörper anzeigen
- PARD6B (Par-6 Partitioning Defective 6 Homolog beta (PARD6B))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARD6B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PARD6 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHV
- Top Product
- Discover our top product PARD6B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARD6B Blocking Peptide, catalog no. 33R-6265, is also available for use as a blocking control in assays to test for specificity of this PARD6B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARD6B (Par-6 Partitioning Defective 6 Homolog beta (PARD6B))
- Andere Bezeichnung
- PARD6B (PARD6B Produkte)
- Synonyme
- PARD6B antikoerper, AV025615 antikoerper, Par6b antikoerper, PAR6B antikoerper, par-6 antikoerper, par6 antikoerper, pard6beta antikoerper, si:dkey-192i18.6 antikoerper, PAR-6 antikoerper, PAR-6B antikoerper, par-6 family cell polarity regulator beta antikoerper, par-6 family cell polarity regulator beta S homeolog antikoerper, par-6 partitioning defective 6 homolog beta (C. elegans) antikoerper, PARD6B antikoerper, Pard6b antikoerper, pard6b.S antikoerper, pard6b antikoerper
- Hintergrund
- This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-