LYPLA1 Antikörper (Middle Region)

Produktnummer ABIN630946

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch LYPLA1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für LYPLA1 Antikörper (Middle Region) (ABIN630946)

Target: LYPLA1 (Lysophospholipase I (LYPLA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYPLA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LYPLA1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LYPLA1 antibody was raised against the middle region of LYPLA1

Aufreinigung: Affinity purified

Immunogen: LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYPLA1 Blocking Peptide, (ABIN5614613), is also available for use as a blocking control in assays to test for specificity of this LYPLA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYPLA1

Target: LYPLA1 (Lysophospholipase I (LYPLA1))

Andere Bezeichnung: LYPLA1

Hintergrund: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.

Molekulargewicht: 25 kDa (MW of target protein)