LYPLA1 Antikörper (Middle Region)
-
- Target Alle LYPLA1 Antikörper anzeigen
- LYPLA1 (Lysophospholipase I (LYPLA1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LYPLA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LYPLA1 antibody was raised against the middle region of LYPLA1
- Aufreinigung
- Affinity purified
- Immunogen
- LYPLA1 antibody was raised using the middle region of LYPLA1 corresponding to a region with amino acids SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
- Top Product
- Discover our top product LYPLA1 Primärantikörper
-
anti-Lysophospholipase I (LYPLA1) (AA 66-151) antibody
LYPLA1 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 3D5 unconjugated
anti-Lysophospholipase I (LYPLA1) (AA 1-230) antibodyLYPLA1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Lysophospholipase I (LYPLA1) (AA 133-230) antibodyLYPLA1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Lysophospholipase I (LYPLA1) (Internal Region) antibodyLYPLA1 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Lysophospholipase I (LYPLA1) (AA 1-230) antibodyLYPLA1 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Lysophospholipase I (LYPLA1) (Center) antibodyLYPLA1 Reaktivität: Human, Maus, Ratte, Kaninchen WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Lysophospholipase I (LYPLA1) (Internal Region) antibodyLYPLA1 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Lysophospholipase I (LYPLA1) (AA 1-230) antibodyLYPLA1 Reaktivität: Maus ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Lysophospholipase I (LYPLA1) (Internal Region) antibodyLYPLA1 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Lysophospholipase I (LYPLA1) (AA 65-94) antibodyLYPLA1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB39836 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LYPLA1 Blocking Peptide, catalog no. 33R-8940, is also available for use as a blocking control in assays to test for specificity of this LYPLA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LYPLA1 (Lysophospholipase I (LYPLA1))
- Andere Bezeichnung
- LYPLA1 (LYPLA1 Produkte)
- Synonyme
- APT-1 antikoerper, APT1 antikoerper, LPL-I antikoerper, LPL1 antikoerper, hAPT1 antikoerper, Pla1a antikoerper, 25KDL antikoerper, zgc:110260 antikoerper, lysophospholipase I antikoerper, lysophospholipase 1 antikoerper, lysophospholipase I L homeolog antikoerper, LYPLA1 antikoerper, Lypla1 antikoerper, lypla1 antikoerper, lypla1.L antikoerper
- Hintergrund
- Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. LYPLA1 hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.
- Molekulargewicht
- 25 kDa (MW of target protein)
-
