PDE12 Antikörper (Middle Region)

Produktnummer ABIN630935

Produktdetails anti-PDE12 Antikörper

Target: PDE12 (Phosphodiesterase 12 (PDE12))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: 2'-PDE antibody was raised against the middle region of 2'-Pde

Aufreinigung: Affinity purified

Immunogen: 2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

2'-PDE Blocking Peptide, catalog no. 33R-1734, is also available for use as a blocking control in assays to test for specificity of this 2'-PDE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 2'-PDE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE12

Target: PDE12 (Phosphodiesterase 12 (PDE12))

Andere Bezeichnung: 2'-PDE (PDE12 Produkte)

Synonyme: 2'-PDE antikoerper, E430028B21Rik antikoerper, LRRGT00074 antikoerper, RGD1310975 antikoerper, phosphodiesterase 12 S homeolog antikoerper, phosphodiesterase 12 antikoerper, pde12.S antikoerper, PDE12 antikoerper, pde12 antikoerper, Pde12 antikoerper

Hintergrund: 2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.

Molekulargewicht: 67 kDa (MW of target protein)