ATP6V1E2 Antikörper (Middle Region)

Produktnummer ABIN630933

Produktdetails anti-ATP6V1E2 Antikörper

Target: ATP6V1E2 (ATPase, H+ Transporting, Lysosomal 31kDa, V1 Subunit E2 (ATP6V1E2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6V1E2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2

Aufreinigung: Affinity purified

Immunogen: ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6V1E2 Blocking Peptide, catalog no. 33R-5212, is also available for use as a blocking control in assays to test for specificity of this ATP6V1E2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6V1E2

Target: ATP6V1E2 (ATPase, H+ Transporting, Lysosomal 31kDa, V1 Subunit E2 (ATP6V1E2))

Andere Bezeichnung: ATP6V1E2 (ATP6V1E2 Produkte)

Synonyme: ATP6E1 antikoerper, ATP6EL2 antikoerper, ATP6V1EL2 antikoerper, VMA4 antikoerper, 4930500C14Rik antikoerper, Atp6e1 antikoerper, E1 antikoerper, ATPase H+ transporting V1 subunit E2 antikoerper, ATPase, H+ transporting, lysosomal V1 subunit E2 antikoerper, Atp6v1e2 antikoerper, ATP6V1E2 antikoerper

Hintergrund: ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport