MAP3K1 Antikörper (C-Term)

Produktnummer ABIN630931

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MAP3K1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MAP3K1 Antikörper (C-Term) (ABIN630931)

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP3K1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MAP3K1 Antikörper

Bindungsspezifität: C-Term

Spezifität: MAP3 K1 antibody was raised against the C terminal of MAP3 1

Aufreinigung: Affinity purified

Immunogen: MAP3 K1 antibody was raised using the C terminal of MAP3 1 corresponding to a region with amino acids LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP3K1 Blocking Peptide, (ABIN940346), is also available for use as a blocking control in assays to test for specificity of this MAP3K1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP3K1

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Andere Bezeichnung: MAP3K1

Hintergrund: MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin and many growth factors.

Molekulargewicht: 164 kDa (MW of target protein)

Pathways: MAPK Signalweg, Interferon-gamma Pathway, Caspase Kaskade in der Apoptose, TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades