PSMB2 Antikörper
-
- Target Alle PSMB2 Antikörper anzeigen
- PSMB2 (Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD
- Top Product
- Discover our top product PSMB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMB2 Blocking Peptide, catalog no. 33R-4864, is also available for use as a blocking control in assays to test for specificity of this PSMB2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMB2 (Proteasome (Prosome, Macropain) Subunit, beta Type 2 (PSMB2))
- Andere Bezeichnung
- PSMB2 (PSMB2 Produkte)
- Synonyme
- HC7-I antikoerper, 19.m02268 antikoerper, DDBDRAFT_0190287 antikoerper, DDBDRAFT_0232958 antikoerper, DDB_0190287 antikoerper, DDB_0232958 antikoerper, Psmb2 antikoerper, ACYPI004276 antikoerper, AU045357 antikoerper, AW108089 antikoerper, C7-I antikoerper, D4Wsu33e antikoerper, zgc:92282 antikoerper, proteasome subunit beta 2 antikoerper, proteasome subunit beta type 2 antikoerper, proteasome beta 2 subunit antikoerper, putative proteasome beta 2 subunit antikoerper, 20S proteasome subunit beta-2 antikoerper, proteasome (prosome, macropain) subunit, beta type 2 antikoerper, proteasome subunit beta 2 L homeolog antikoerper, PSMB2 antikoerper, CNC04990 antikoerper, Tc00.1047053510287.30 antikoerper, Tc00.1047053503891.100 antikoerper, Tc00.1047053508461.430 antikoerper, LBRM_34_3820 antikoerper, LBRM_35_0400 antikoerper, BBOV_I004450 antikoerper, LMJF_36_0320 antikoerper, psmB2 antikoerper, Psmb2 antikoerper, psmb2 antikoerper, psmb2.L antikoerper
- Hintergrund
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB2 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.
- Molekulargewicht
- 23 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-