PSMB1 Antikörper

Produktnummer ABIN630913

Produktdetails anti-PSMB1 Antikörper

Target: PSMB1 (Proteasome (Prosome, Macropain) Subunit, beta Type, 1 (PSMB1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMB1 Blocking Peptide, catalog no. 33R-6806, is also available for use as a blocking control in assays to test for specificity of this PSMB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMB1

Target: PSMB1 (Proteasome (Prosome, Macropain) Subunit, beta Type, 1 (PSMB1))

Andere Bezeichnung: PSMB1 (PSMB1 Produkte)

Synonyme: DDBDRAFT_0217063 antikoerper, DDBDRAFT_0232957 antikoerper, DDB_0217063 antikoerper, DDB_0232957 antikoerper, AA409053 antikoerper, C81484 antikoerper, Lmpc5 antikoerper, HC5 antikoerper, PMSB1 antikoerper, PSC5 antikoerper, wu:fc51f06 antikoerper, zgc:103665 antikoerper, proteasome subunit beta 1 antikoerper, 20S proteasome subunit beta-1 antikoerper, proteasome subunit beta type 1 antikoerper, proteasome (prosome, macropain) subunit, beta type 1 antikoerper, proteasome subunit beta 1 S homeolog antikoerper, psmb1 antikoerper, PSMB1 antikoerper, psmB1 antikoerper, LOC100286342 antikoerper, Psmb1 antikoerper, psmb1.S antikoerper

Hintergrund: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB1 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA