HUS1B Antikörper

Produktnummer ABIN630912

Produktdetails anti-HUS1B Antikörper

Target: HUS1B (HUS1 Checkpoint Homolog B (HUS1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HUS1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HUS1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HUS1B Blocking Peptide, catalog no. 33R-2540, is also available for use as a blocking control in assays to test for specificity of this HUS1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HUS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HUS1B

Target: HUS1B (HUS1 Checkpoint Homolog B (HUS1B))

Andere Bezeichnung: HUS1B (HUS1B Produkte)

Synonyme: HUS1B antikoerper, RP11-532F6.1 antikoerper, HUS1 checkpoint clamp component B antikoerper, HUS1B antikoerper, Hus1b antikoerper

Hintergrund: HUS1Bis most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. HUS1B can interact with the check point protein RAD1 but not with RAD9. Overexpression of HUS1B has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.

Molekulargewicht: 31 kDa (MW of target protein)