PPIA Antikörper
-
- Target Alle PPIA Antikörper anzeigen
- PPIA (Peptidylprolyl Isomerase A (Cyclophilin A) (PPIA))
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPIA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids FRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFED
- Top Product
- Discover our top product PPIA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPIA Blocking Peptide, catalog no. 33R-3038, is also available for use as a blocking control in assays to test for specificity of this PPIA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIA (Peptidylprolyl Isomerase A (Cyclophilin A) (PPIA))
- Andere Bezeichnung
- PPIA (PPIA Produkte)
- Synonyme
- Cyp1 antikoerper, PPIA-2 antikoerper, fa93g09 antikoerper, ppia antikoerper, wu:fa93g09 antikoerper, wu:fb05e11 antikoerper, wu:fb13h02 antikoerper, wu:fb15a05 antikoerper, CYPA antikoerper, CypA antikoerper, Cypa antikoerper, CYPH antikoerper, CYCA antikoerper, CyP-A antikoerper, MGC75715 antikoerper, 2700098C05 antikoerper, Cphn antikoerper, CyP-18 antikoerper, MT-ND1 antikoerper, MTND1 antikoerper, NADH1 antikoerper, ND1 antikoerper, cypA antikoerper, PPIase A antikoerper, ppial antikoerper, wu:fj18g05 antikoerper, zgc:73102 antikoerper, zgc:86688 antikoerper, peptidylprolyl isomerase A antikoerper, peptidylprolyl isomerase Aa (cyclophilin A) antikoerper, peptidylprolyl isomerase A (cyclophilin A) L homeolog antikoerper, cyclophilin A antikoerper, cyclophilin a antikoerper, peptidylprolyl isomerase A (cyclophilin A) antikoerper, peptidylprolyl isomerase Ab (cyclophilin A) antikoerper, PPIA antikoerper, ppiaa antikoerper, ppia.L antikoerper, Cypa antikoerper, CNB01230 antikoerper, CNB01290 antikoerper, Tc00.1047053506925.300 antikoerper, Tb11.03.0250 antikoerper, CYPA antikoerper, Ppia antikoerper, ppia antikoerper, ppiab antikoerper
- Hintergrund
- PPIA is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. PPIA is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
- Molekulargewicht
- 18 kDa (MW of target protein)
-