ARG2 Antikörper (Arg2, C-Term)

Produktnummer ABIN630895

Produktdetails anti-ARG2 Antikörper

Target: ARG2 (Arginase, Type II (ARG2))

Bindungsspezifität: Arg2, C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Arginase 2 antibody was raised against the C terminal of ARG2

Aufreinigung: Affinity purified

Immunogen: Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Arginase 2 Blocking Peptide, catalog no. 33R-8306, is also available for use as a blocking control in assays to test for specificity of this Arginase 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARG2

Target: ARG2 (Arginase, Type II (ARG2))

Andere Bezeichnung: Arginase 2 (ARG2 Produkte)

Synonyme: AII antikoerper, AU022422 antikoerper, zgc:65793 antikoerper, zgc:85630 antikoerper, wu:fb67g02 antikoerper, ARG2 antikoerper, LeARG2 antikoerper, arg1 antikoerper, arg3 antikoerper, arg2 antikoerper, arg2-c antikoerper, arg2-b antikoerper, arginase 2 antikoerper, arginase type II antikoerper, arginase 2 L homeolog antikoerper, arginase 2 S homeolog antikoerper, ARG2 antikoerper, Arg2 antikoerper, arg2 antikoerper, arg2.L antikoerper, arg2.S antikoerper

Hintergrund: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood, it is thought to play a role in nitric oxide and polyamine metabolism.

Molekulargewicht: 36 kDa (MW of target protein)