MYL6 Antikörper (N-Term)

Produktnummer ABIN630884

Produktdetails anti-MYL6 Antikörper

Target: MYL6 (Myosin Light Chain 6, Alkali, Smooth Muscle and Non Muscle (MYL6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MYL6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MYL6 antibody was raised against the N terminal of MYL6

Aufreinigung: Affinity purified

Immunogen: MYL6 antibody was raised using the N terminal of MYL6 corresponding to a region with amino acids CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MYL6 Blocking Peptide, catalog no. 33R-1660, is also available for use as a blocking control in assays to test for specificity of this MYL6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MYL6

Target: MYL6 (Myosin Light Chain 6, Alkali, Smooth Muscle and Non Muscle (MYL6))

Andere Bezeichnung: MYL6 (MYL6 Produkte)

Synonyme: ESMLC antikoerper, LC17 antikoerper, LC17-GI antikoerper, LC17-NM antikoerper, LC17A antikoerper, LC17B antikoerper, MLC-3 antikoerper, MLC1SM antikoerper, MLC3NM antikoerper, MLC3SM antikoerper, zgc:103624 antikoerper, MLC3nm antikoerper, Myln antikoerper, myosin light chain 6 antikoerper, myosin, light chain 6, alkali, smooth muscle and non-muscle antikoerper, myosin light chain 6 L homeolog antikoerper, myosin, light polypeptide 6, alkali, smooth muscle and non-muscle antikoerper, MYL6 antikoerper, Myl6 antikoerper, myl6 antikoerper, myl6.L antikoerper

Hintergrund: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Molekulargewicht: 17 kDa (MW of target protein)