MYL6 Antikörper (N-Term)
-
- Target Alle MYL6 Antikörper anzeigen
- MYL6 (Myosin Light Chain 6, Alkali, Smooth Muscle and Non Muscle (MYL6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MYL6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MYL6 antibody was raised against the N terminal of MYL6
- Aufreinigung
- Affinity purified
- Immunogen
- MYL6 antibody was raised using the N terminal of MYL6 corresponding to a region with amino acids CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV
- Top Product
- Discover our top product MYL6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MYL6 Blocking Peptide, catalog no. 33R-1660, is also available for use as a blocking control in assays to test for specificity of this MYL6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MYL6 (Myosin Light Chain 6, Alkali, Smooth Muscle and Non Muscle (MYL6))
- Andere Bezeichnung
- MYL6 (MYL6 Produkte)
- Synonyme
- ESMLC antikoerper, LC17 antikoerper, LC17-GI antikoerper, LC17-NM antikoerper, LC17A antikoerper, LC17B antikoerper, MLC-3 antikoerper, MLC1SM antikoerper, MLC3NM antikoerper, MLC3SM antikoerper, zgc:103624 antikoerper, MLC3nm antikoerper, Myln antikoerper, myosin light chain 6 antikoerper, myosin, light chain 6, alkali, smooth muscle and non-muscle antikoerper, myosin light chain 6 L homeolog antikoerper, myosin, light polypeptide 6, alkali, smooth muscle and non-muscle antikoerper, MYL6 antikoerper, Myl6 antikoerper, myl6 antikoerper, myl6.L antikoerper
- Hintergrund
- MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.
- Molekulargewicht
- 17 kDa (MW of target protein)
-