TNPO2 Antikörper

Produktnummer ABIN630874

Produktdetails anti-TNPO2 Antikörper

Target: TNPO2 (Transportin 2 (TNPO2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNPO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Transportin 2 Blocking Peptide, catalog no. 33R-5883, is also available for use as a blocking control in assays to test for specificity of this Transportin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNPO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNPO2

Target: TNPO2 (Transportin 2 (TNPO2))

Andere Bezeichnung: Transportin 2 (TNPO2 Produkte)

Synonyme: TNPO2 antikoerper, IPO3 antikoerper, KPNB2B antikoerper, TRN2 antikoerper, ik:tdsubc_2a7 antikoerper, tdsubc_2a7 antikoerper, wu:fb01c02 antikoerper, wu:fe01f03 antikoerper, wu:fe16e12 antikoerper, xx:tdsubc_2a7 antikoerper, zgc:101009 antikoerper, 1110034O24Rik antikoerper, AA414969 antikoerper, AI464345 antikoerper, AI852433 antikoerper, Knpb2b antikoerper, Kpnb2b antikoerper, transportin 2 antikoerper, transportin 2 L homeolog antikoerper, transportin 2 (importin 3, karyopherin beta 2b) antikoerper, TNPO2 antikoerper, tnpo2.L antikoerper, Tnpo2 antikoerper, tnpo2 antikoerper

Hintergrund: Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

Molekulargewicht: 100 kDa (MW of target protein)