PDE4B Antikörper

Produktnummer ABIN630858

Produktdetails anti-PDE4B Antikörper

Target: PDE4B (phosphodiesterase 4B, cAMP-Specific (PDE4B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PDE4 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE4B Blocking Peptide, catalog no. 33R-7502, is also available for use as a blocking control in assays to test for specificity of this PDE4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE4B

Target: PDE4B (phosphodiesterase 4B, cAMP-Specific (PDE4B))

Andere Bezeichnung: PDE4B (PDE4B Produkte)

Synonyme: dpde4 antikoerper, pde4b5 antikoerper, pdeivb antikoerper, Dpde4 antikoerper, R74983 antikoerper, dunce antikoerper, PDE4/IVb antikoerper, Pde4B1 antikoerper, Pde4B2 antikoerper, Pde4B3 antikoerper, Pde4B4 antikoerper, DPDE4 antikoerper, PDE4B5 antikoerper, PDEIVB antikoerper, phosphodiesterase 4B antikoerper, phosphodiesterase 4B, cAMP specific antikoerper, phosphodiesterase 4B S homeolog antikoerper, pde4b antikoerper, PDE4B antikoerper, Pde4b antikoerper, pde4b.S antikoerper

Hintergrund: This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, cAMP Metabolic Process, Myometrial Relaxation and Contraction