TRIML1 Antikörper (Middle Region)

Produktnummer ABIN630846

Produktdetails anti-TRIML1 Antikörper

Target: TRIML1 (Tripartite Motif Family-Like 1 (TRIML1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIML1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIML1 antibody was raised against the middle region of TRIML1

Aufreinigung: Affinity purified

Immunogen: TRIML1 antibody was raised using the middle region of TRIML1 corresponding to a region with amino acids DSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIML1 Blocking Peptide, catalog no. 33R-2184, is also available for use as a blocking control in assays to test for specificity of this TRIML1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIML1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIML1

Target: TRIML1 (Tripartite Motif Family-Like 1 (TRIML1))

Andere Bezeichnung: TRIML1 (TRIML1 Produkte)

Synonyme: RNF209 antikoerper, 4933403D14 antikoerper, BC050188 antikoerper, RGD1305337 antikoerper, tripartite motif family-like 1 antikoerper, tripartite motif family like 1 antikoerper, TRIML1 antikoerper, Triml1 antikoerper

Hintergrund: TRIML1 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of the TRIML1 protein remains unknown.

Molekulargewicht: 53 kDa (MW of target protein)