ENO3 Antikörper
-
- Target Alle ENO3 Antikörper anzeigen
- ENO3 (Enolase 3 (Beta, Muscle) (ENO3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ENO3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Enolase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
- Top Product
- Discover our top product ENO3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Enolase 3 Blocking Peptide, catalog no. 33R-2776, is also available for use as a blocking control in assays to test for specificity of this Enolase 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENO3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ENO3 (Enolase 3 (Beta, Muscle) (ENO3))
- Andere Bezeichnung
- Enolase 3 (ENO3 Produkte)
- Synonyme
- ENO3 antikoerper, GSD13 antikoerper, MSE antikoerper, ENO1 antikoerper, cb883 antikoerper, fj24f12 antikoerper, wu:fj24f12 antikoerper, Eno-3 antikoerper, BBE antikoerper, enolase 3 (beta, muscle) L homeolog antikoerper, enolase 3 antikoerper, enolase 3 (beta, muscle) antikoerper, enolase 3, (beta, muscle) antikoerper, enolase 3, beta muscle antikoerper, eno3.L antikoerper, ENO3 antikoerper, eno3 antikoerper, Eno3 antikoerper
- Hintergrund
- ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.
- Molekulargewicht
- 47 kDa (MW of target protein)
-