TRIM37 Antikörper (Middle Region)

Produktnummer ABIN630817

Produktdetails anti-TRIM37 Antikörper

Target: TRIM37 (Tripartite Motif Containing 37 (TRIM37))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM37 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM37 antibody was raised against the middle region of TRIM37

Aufreinigung: Affinity purified

Immunogen: TRIM37 antibody was raised using the middle region of TRIM37 corresponding to a region with amino acids GMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM37 Blocking Peptide, catalog no. 33R-3441, is also available for use as a blocking control in assays to test for specificity of this TRIM37 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM37 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM37

Target: TRIM37 (Tripartite Motif Containing 37 (TRIM37))

Andere Bezeichnung: TRIM37 (TRIM37 Produkte)

Synonyme: MUL antikoerper, POB1 antikoerper, TEF3 antikoerper, 1110032A10Rik antikoerper, 2810004E07Rik antikoerper, AI848587 antikoerper, AU043018 antikoerper, mKIAA0898 antikoerper, tripartite motif-containing 37 antikoerper, tripartite motif containing 37 antikoerper, Trim37 antikoerper, TRIM37 antikoerper

Hintergrund: This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis.

Molekulargewicht: 108 kDa (MW of target protein)