LCP1 Antikörper
-
- Target Alle LCP1 Antikörper anzeigen
- LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LCP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK
- Top Product
- Discover our top product LCP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LCP1 Blocking Peptide, catalog no. 33R-2929, is also available for use as a blocking control in assays to test for specificity of this LCP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))
- Andere Bezeichnung
- LCP1 (LCP1 Produkte)
- Synonyme
- CP64 antikoerper, L-PLASTIN antikoerper, LC64P antikoerper, LPL antikoerper, PLS2 antikoerper, cb245 antikoerper, fj24b12 antikoerper, wu:fj24b12 antikoerper, cp64 antikoerper, l-plastin antikoerper, lc64p antikoerper, lpl antikoerper, pls2 antikoerper, plastin-2 antikoerper, AW536232 antikoerper, D14Ertd310e antikoerper, LCP-1 antikoerper, Pls2 antikoerper, pp65 antikoerper, lymphocyte cytosolic protein 1 antikoerper, lymphocyte cytosolic protein 1 (L-plastin) antikoerper, lymphocyte cytosolic protein 1 (L-plastin) S homeolog antikoerper, lower matrix protein; involved in immune regulation antikoerper, LCP1 antikoerper, lcp1 antikoerper, lcp1.S antikoerper, Lcp1 antikoerper, UL83 antikoerper
- Hintergrund
- Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages. However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.
- Molekulargewicht
- 70 kDa (MW of target protein)
-