LCP1 Antikörper

Produktnummer ABIN630794

Produktdetails anti-LCP1 Antikörper

Target: LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LCP1 Blocking Peptide, catalog no. 33R-2929, is also available for use as a blocking control in assays to test for specificity of this LCP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCP1

Target: LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))

Andere Bezeichnung: LCP1 (LCP1 Produkte)

Synonyme: CP64 antikoerper, L-PLASTIN antikoerper, LC64P antikoerper, LPL antikoerper, PLS2 antikoerper, cb245 antikoerper, fj24b12 antikoerper, wu:fj24b12 antikoerper, cp64 antikoerper, l-plastin antikoerper, lc64p antikoerper, lpl antikoerper, pls2 antikoerper, plastin-2 antikoerper, AW536232 antikoerper, D14Ertd310e antikoerper, LCP-1 antikoerper, Pls2 antikoerper, pp65 antikoerper, lymphocyte cytosolic protein 1 antikoerper, lymphocyte cytosolic protein 1 (L-plastin) antikoerper, lymphocyte cytosolic protein 1 (L-plastin) S homeolog antikoerper, lower matrix protein; involved in immune regulation antikoerper, LCP1 antikoerper, lcp1 antikoerper, lcp1.S antikoerper, Lcp1 antikoerper, UL83 antikoerper

Hintergrund: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages. However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.

Molekulargewicht: 70 kDa (MW of target protein)