CCDC50 Antikörper (Middle Region)

Produktnummer ABIN630791

Produktdetails anti-CCDC50 Antikörper

Target: CCDC50 (Coiled-Coil Domain Containing 50 (CCDC50))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC50 antibody was raised against the middle region of CCDC50

Aufreinigung: Affinity purified

Immunogen: CCDC50 antibody was raised using the middle region of CCDC50 corresponding to a region with amino acids GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC50 Blocking Peptide, catalog no. 33R-3435, is also available for use as a blocking control in assays to test for specificity of this CCDC50 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC50

Target: CCDC50 (Coiled-Coil Domain Containing 50 (CCDC50))

Andere Bezeichnung: CCDC50 (CCDC50 Produkte)

Synonyme: ymer antikoerper, C3orf6 antikoerper, DFNA44 antikoerper, YMER antikoerper, 2610529H08Rik antikoerper, 5730448P06Rik antikoerper, AW048328 antikoerper, AW546090 antikoerper, D16Bwg1543e antikoerper, C3orf6h antikoerper, c3orf6 antikoerper, coiled-coil domain containing 50 antikoerper, coiled-coil domain containing 50 L homeolog antikoerper, CCDC50 antikoerper, ccdc50.L antikoerper, ccdc50 antikoerper, Ccdc50 antikoerper

Hintergrund: CCDC50 is a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling.

Molekulargewicht: 56 kDa (MW of target protein)