GLT6D1 Antikörper (Middle Region)

Produktnummer ABIN630779

Produktdetails anti-GLT6D1 Antikörper

Target: GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLT6D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLT6 D1 antibody was raised against the middle region of GLT6 1

Aufreinigung: Affinity purified

Immunogen: GLT6 D1 antibody was raised using the middle region of GLT6 1 corresponding to a region with amino acids FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLT6D1 Blocking Peptide, catalog no. 33R-2916, is also available for use as a blocking control in assays to test for specificity of this GLT6D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLT6D1

Target: GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))

Andere Bezeichnung: GLT6D1 (GLT6D1 Produkte)

Synonyme: GLTDC1 antikoerper, GT6M7 antikoerper, GT6m7 antikoerper, Gltdc1 antikoerper, 4933411C14Rik antikoerper, QtsA-20904 antikoerper, glycosyltransferase 6 domain containing 1 antikoerper, GLT6D1 antikoerper, Glt6d1 antikoerper

Hintergrund: GLT6D1 is a single-pass type II membrane protein. It belongs to the glycosyltransferase 6 family. The exact function of GLT6D1 remains unknown.

Molekulargewicht: 32 kDa (MW of target protein)