CA1 Antikörper (N-Term)

Produktnummer ABIN630776

Produktdetails anti-CA1 Antikörper

Target: CA1 (Carbonic Anhydrase I (CA1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Carbonic Anhydrase I antibody was raised against the N terminal of CA1

Aufreinigung: Affinity purified

Immunogen: Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonic Anhydrase I Blocking Peptide, catalog no. 33R-1519, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CA1

Target: CA1 (Carbonic Anhydrase I (CA1))

Andere Bezeichnung: Carbonic Anhydrase I (CA1 Produkte)

Synonyme: CA-I antikoerper, CAB antikoerper, Car1 antikoerper, AW555628 antikoerper, Ca1 antikoerper, Car-1 antikoerper, BG:DS00941.1 antikoerper, CAH antikoerper, CG7820 antikoerper, Dmel\\CG7820 antikoerper, Gh7 antikoerper, ARABIDOPSIS THALIANA SALICYLIC ACID-BINDING PROTEIN 3 antikoerper, ATBCA1 antikoerper, ATSABP3 antikoerper, BETA CARBONIC ANHYDRASE 1 antikoerper, F4P13.5 antikoerper, F4P13_5 antikoerper, SABP3 antikoerper, SALICYLIC ACID-BINDING PROTEIN 3 antikoerper, carbonic anhydrase 1 antikoerper, CA1 antikoerper, LOC100135826 antikoerper, GB15888 antikoerper, carbonic anhydrase 1 antikoerper, Carbonic anhydrase 1 antikoerper, carbonic anhydrase I antikoerper, carbonic anhydrase antikoerper, CA1 antikoerper, Car1 antikoerper, CAH1 antikoerper, LOC100135826 antikoerper, LOC408827 antikoerper, Tsp_05114 antikoerper, LOC100153915 antikoerper, LOC100050192 antikoerper, Ca1 antikoerper

Hintergrund: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes.

Molekulargewicht: 29 kDa (MW of target protein)