CA1 Antikörper (N-Term)

Produktnummer ABIN630776

Der Kaninchen Polyklonal anti-CA1 Antikörper wird verwendet zum Nachweis von CA1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CA1 Antikörper (N-Term) (ABIN630776)

Target: CA1 (Carbonic Anhydrase I (CA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CA1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Carbonic Anhydrase I antibody was raised against the N terminal of CA1

Aufreinigung: Affinity purified

Immunogen: Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carbonic Anhydrase I Blocking Peptide, (ABIN936905), is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CA1

Target: CA1 (Carbonic Anhydrase I (CA1))

Andere Bezeichnung: Carbonic Anhydrase I

Hintergrund: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes.

Molekulargewicht: 29 kDa (MW of target protein)