HIRIP3 Antikörper (Middle Region)
-
- Target Alle HIRIP3 Antikörper anzeigen
- HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HIRIP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HIRIP3 antibody was raised against the middle region of HIRIP3
- Aufreinigung
- Affinity purified
- Immunogen
- HIRIP3 antibody was raised using the middle region of HIRIP3 corresponding to a region with amino acids RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK
- Top Product
- Discover our top product HIRIP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HIRIP3 Blocking Peptide, catalog no. 33R-8235, is also available for use as a blocking control in assays to test for specificity of this HIRIP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIRIP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))
- Andere Bezeichnung
- HIRIP3 (HIRIP3 Produkte)
- Synonyme
- HIRIP3 antikoerper, fi16e03 antikoerper, wu:fi16e03 antikoerper, zgc:66480 antikoerper, B130036O03 antikoerper, C86302 antikoerper, HIRA interacting protein 3 antikoerper, HIRIP3 antikoerper, hirip3 antikoerper, Hirip3 antikoerper
- Hintergrund
- The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae.
- Molekulargewicht
- 61 kDa (MW of target protein)
-