HIRIP3 Antikörper (Middle Region)

Produktnummer ABIN630758

Der Kaninchen Polyklonal anti-HIRIP3 Antikörper wird verwendet zum Nachweis von HIRIP3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für HIRIP3 Antikörper (Middle Region) (ABIN630758)

Target: HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HIRIP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HIRIP3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HIRIP3 antibody was raised against the middle region of HIRIP3

Aufreinigung: Affinity purified

Immunogen: HIRIP3 antibody was raised using the middle region of HIRIP3 corresponding to a region with amino acids RTRSSSSSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HIRIP3 Blocking Peptide, (ABIN5614006), is also available for use as a blocking control in assays to test for specificity of this HIRIP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIRIP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HIRIP3

Target: HIRIP3 (HIRA Interacting Protein 3 (HIRIP3))

Andere Bezeichnung: HIRIP3

Hintergrund: The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae.

Molekulargewicht: 61 kDa (MW of target protein)