RALGPS2 Antikörper (N-Term)
-
- Target Alle RALGPS2 Antikörper anzeigen
- RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2 (RALGPS2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RALGPS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RALGPS2 antibody was raised against the n terminal of RALGPS2
- Aufreinigung
- Affinity purified
- Immunogen
- RALGPS2 antibody was raised using the N terminal of RALGPS2 corresponding to a region with amino acids MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP
- Top Product
- Discover our top product RALGPS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RALGPS2 Blocking Peptide, catalog no. 33R-5849, is also available for use as a blocking control in assays to test for specificity of this RALGPS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2 (RALGPS2))
- Andere Bezeichnung
- RALGPS2 (RALGPS2 Produkte)
- Synonyme
- RALGPS1 antikoerper, RALGPS2 antikoerper, dJ595C2.1 antikoerper, 1810020P17Rik antikoerper, 2210408F11Rik antikoerper, 4921528G01Rik antikoerper, 9130014M22Rik antikoerper, AU043409 antikoerper, AW046161 antikoerper, Ral GEF with PH domain and SH3 binding motif 2 antikoerper, RALGPS2 antikoerper, ralgps2 antikoerper, Ralgps2 antikoerper
- Hintergrund
- RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.
- Molekulargewicht
- 32 kDa (MW of target protein)
-