PHLDA1 Antikörper (Middle Region)
-
- Target Alle PHLDA1 Antikörper anzeigen
- PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PHLDA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PHLDA1 antibody was raised against the middle region of PHLDA1
- Aufreinigung
- Affinity purified
- Immunogen
- PHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
- Top Product
- Discover our top product PHLDA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PHLDA1 Blocking Peptide, catalog no. 33R-6986, is also available for use as a blocking control in assays to test for specificity of this PHLDA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))
- Andere Bezeichnung
- PHLDA1 (PHLDA1 Produkte)
- Synonyme
- DT1P1B11 antikoerper, PHRIP antikoerper, TDAG51 antikoerper, Tdag antikoerper, pleckstrin homology like domain family A member 1 antikoerper, pleckstrin homology like domain, family A, member 1 antikoerper, pleckstrin homology-like domain, family A, member 1 antikoerper, pleckstrin homology-like domain, family A, member 1 L homeolog antikoerper, PHLDA1 antikoerper, Phlda1 antikoerper, phlda1.L antikoerper
- Hintergrund
- PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.
- Molekulargewicht
- 45 kDa (MW of target protein)
-