ECHDC1 Antikörper (Middle Region)

Produktnummer ABIN630734

Produktdetails anti-ECHDC1 Antikörper

Target: ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ECHDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ECHDC1 antibody was raised against the middle region of ECHDC1

Aufreinigung: Affinity purified

Immunogen: ECHDC1 antibody was raised using the middle region of ECHDC1 corresponding to a region with amino acids GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ECHDC1 Blocking Peptide, catalog no. 33R-3646, is also available for use as a blocking control in assays to test for specificity of this ECHDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ECHDC1

Target: ECHDC1 (Enoyl CoA Hydratase Domain Containing 1 (ECHDC1))

Andere Bezeichnung: ECHDC1 (ECHDC1 Produkte)

Synonyme: MMCD antikoerper, dJ351K20.2 antikoerper, 1700028A24Rik antikoerper, AI314462 antikoerper, AI930038 antikoerper, D10Ertd667e antikoerper, MGC110060 antikoerper, zgc:110060 antikoerper, ethylmalonyl-CoA decarboxylase 1 antikoerper, ethylmalonyl-CoA decarboxylase 1 L homeolog antikoerper, enoyl Coenzyme A hydratase domain containing 1 antikoerper, enoyl CoA hydratase domain containing 1 antikoerper, echdc1 antikoerper, ECHDC1 antikoerper, echdc1.L antikoerper, Echdc1 antikoerper

Hintergrund: ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown.

Molekulargewicht: 33 kDa (MW of target protein)