POLR3A Antikörper (Middle Region)
-
- Target Alle POLR3A Antikörper anzeigen
- POLR3A (Polymerase (RNA) III (DNA Directed) Polypeptide A, 155kDa (POLR3A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POLR3A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- POLR3 A antibody was raised against the middle region of POLR3
- Aufreinigung
- Affinity purified
- Immunogen
- POLR3 A antibody was raised using the middle region of POLR3 corresponding to a region with amino acids AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT
- Top Product
- Discover our top product POLR3A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POLR3A Blocking Peptide, catalog no. 33R-1627, is also available for use as a blocking control in assays to test for specificity of this POLR3A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR3A (Polymerase (RNA) III (DNA Directed) Polypeptide A, 155kDa (POLR3A))
- Andere Bezeichnung
- POLR3A (POLR3A Produkte)
- Synonyme
- 9330175N20Rik antikoerper, BC053071 antikoerper, RPC1 antikoerper, RPC155 antikoerper, RGD1305574 antikoerper, ADDH antikoerper, HLD7 antikoerper, hRPC155 antikoerper, polymerase (RNA) III (DNA directed) polypeptide A antikoerper, RNA polymerase III subunit A antikoerper, Polr3a antikoerper, POLR3A antikoerper
- Hintergrund
- DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.
- Molekulargewicht
- 156 kDa (MW of target protein)
-