GGPS1 Antikörper (Middle Region)
-
- Target Alle GGPS1 Antikörper anzeigen
- GGPS1 (Geranylgeranyl Diphosphate Synthase 1 (GGPS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GGPS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GGPS1 antibody was raised against the middle region of GGPS1
- Aufreinigung
- Affinity purified
- Immunogen
- GGPS1 antibody was raised using the middle region of GGPS1 corresponding to a region with amino acids LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ
- Top Product
- Discover our top product GGPS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GGPS1 Blocking Peptide, catalog no. 33R-4985, is also available for use as a blocking control in assays to test for specificity of this GGPS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGPS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGPS1 (Geranylgeranyl Diphosphate Synthase 1 (GGPS1))
- Andere Bezeichnung
- GGPS1 (GGPS1 Produkte)
- Synonyme
- geranylgeranyl pyrophosphate synthase 1 antikoerper, DDBDRAFT_0192027 antikoerper, DDBDRAFT_0233098 antikoerper, DDB_0192027 antikoerper, DDB_0233098 antikoerper, GGPPS antikoerper, GGPPS1 antikoerper, 1810026C22Rik antikoerper, 9530089B04Rik antikoerper, AI843169 antikoerper, C79210 antikoerper, Crlf3 antikoerper, rGGPS1a antikoerper, rGGPS1a1 antikoerper, rGGPS1a2 antikoerper, rGGPS1a3 antikoerper, fb05f09 antikoerper, qm antikoerper, wu:fb05f09 antikoerper, zgc:101591 antikoerper, zgc:56514 antikoerper, geranylgeranyl pyrophosphate synthase 1 antikoerper, geranylgeranyl pyrophosphate synthetase antikoerper, geranyl pyrophosphate synthase antikoerper, geranylgeranyl pyrophosphate synthase,chloroplastic antikoerper, geranylgeranyl diphosphate synthase 1 antikoerper, geranylgeranyl diphosphate synthase 1 L homeolog antikoerper, GGPS1 antikoerper, gGPS1 antikoerper, ggps1 antikoerper, Ggps1 antikoerper, ggps1.L antikoerper
- Hintergrund
- GGPS1 is a member of the prenyltransferase family and has geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. The protein is an important precursor of carotenoids and geranylated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Molekulargewicht
- 35 kDa (MW of target protein)
-