NUSAP1 Antikörper (Middle Region)

Produktnummer ABIN630728

Produktdetails anti-NUSAP1 Antikörper

Target: NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUSAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NUSAP1 antibody was raised against the middle region of NUSAP1

Aufreinigung: Affinity purified

Immunogen: NUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUSAP1 Blocking Peptide, catalog no. 33R-1139, is also available for use as a blocking control in assays to test for specificity of this NUSAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUSAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUSAP1

Target: NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))

Andere Bezeichnung: NUSAP1 (NUSAP1 Produkte)

Synonyme: ANKT antikoerper, BM037 antikoerper, LNP antikoerper, NUSAP antikoerper, PRO0310p1 antikoerper, Q0310 antikoerper, SAPL antikoerper, 2610201A12Rik antikoerper, AI481307 antikoerper, AW547774 antikoerper, BB165529 antikoerper, NuSAP antikoerper, YF-9 antikoerper, ankt antikoerper, fb76a01 antikoerper, fi37a11 antikoerper, sb:cb490 antikoerper, wu:fb76a01 antikoerper, wu:fi37a11 antikoerper, lnp antikoerper, nusap antikoerper, nusap1 antikoerper, sapl antikoerper, nucleolar and spindle associated protein 1 antikoerper, nucleolar and spindle associated protein 1 L homeolog antikoerper, nucleolar and spindle associated protein 1 S homeolog antikoerper, NUSAP1 antikoerper, Nusap1 antikoerper, nusap1 antikoerper, nusap1.L antikoerper, nusap1.S antikoerper

Hintergrund: NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.

Molekulargewicht: 49 kDa (MW of target protein)