IVNS1ABP Antikörper (N-Term)

Produktnummer ABIN630725

Produktdetails anti-IVNS1ABP Antikörper

Target: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Bindungsspezifität: N-Term

Reaktivität: Influenza A Virus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IVNS1ABP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Influenza Virus Ns1 A Binding Protein antibody was raised against the N terminal of IVNS1 BP

Kreuzreaktivität: Human, Hund

Aufreinigung: Affinity purified

Immunogen: Influenza Virus Ns1 A Binding Protein antibody was raised using the N terminal of IVNS1 BP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Influenza Virus Ns1A Binding Protein Blocking Peptide, catalog no. 33R-7827, is also available for use as a blocking control in assays to test for specificity of this Influenza Virus Ns1A Binding Protein antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVNS0 BP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IVNS1ABP

Target: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Andere Bezeichnung: Influenza Virus Ns1A Binding Protein (IVNS1ABP Produkte)

Synonyme: 1190004M08Rik antikoerper, 1700126I16Rik antikoerper, AA960440 antikoerper, HSPC068 antikoerper, ND1 antikoerper, NS-1 antikoerper, NS1-BP antikoerper, Nd1-L antikoerper, Nd1-S antikoerper, mKIAA0850 antikoerper, cb1052 antikoerper, fj23g11 antikoerper, ivns1abp antikoerper, wu:fj23g11 antikoerper, FLARA3 antikoerper, KLHL39 antikoerper, NS1BP antikoerper, fi13f08 antikoerper, fi41c09 antikoerper, wu:fi13f08 antikoerper, wu:fi41c09 antikoerper, influenza virus NS1A binding protein antikoerper, influenza virus NS1A binding protein a antikoerper, influenza virus NS1A binding protein L homeolog antikoerper, influenza virus NS1A binding protein b antikoerper, Ivns1abp antikoerper, ivns1abpa antikoerper, ivns1abp.L antikoerper, IVNS1ABP antikoerper, ivns1abpb antikoerper

Substanzklasse: Influenza Protein

Hintergrund: This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling