EEF1B2 Antikörper (Middle Region)
-
- Target Alle EEF1B2 Antikörper anzeigen
- EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EEF1B2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EEF1 B2 antibody was raised against the middle region of EEF1 2
- Aufreinigung
- Affinity purified
- Immunogen
- EEF1 B2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE
- Top Product
- Discover our top product EEF1B2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EEF1B2 Blocking Peptide, catalog no. 33R-9624, is also available for use as a blocking control in assays to test for specificity of this EEF1B2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))
- Andere Bezeichnung
- EEF1B2 (EEF1B2 Produkte)
- Synonyme
- EEF1B antikoerper, EEF1B1 antikoerper, EF1B antikoerper, 2810017J07Rik antikoerper, Eef1b antikoerper, fj06d02 antikoerper, wu:fj06d02 antikoerper, zgc:56277 antikoerper, zgc:86802 antikoerper, eef1b antikoerper, ef1b antikoerper, MGC89655 antikoerper, eukaryotic translation elongation factor 1 beta 2 antikoerper, eukaryotic translation elongation factor 1 beta 2 L homeolog antikoerper, EEF1B2 antikoerper, Eef1b2 antikoerper, eef1b2 antikoerper, eef1b2.L antikoerper
- Hintergrund
- EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
- Molekulargewicht
- 25 kDa (MW of target protein)
-