ITGB1BP3 Antikörper (Middle Region)
-
- Target Alle ITGB1BP3 Antikörper anzeigen
- ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ITGB1BP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ITGB1 BP3 antibody was raised against the middle region of ITGB1 P3
- Aufreinigung
- Affinity purified
- Immunogen
- ITGB1 BP3 antibody was raised using the middle region of ITGB1 P3 corresponding to a region with amino acids YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY
- Top Product
- Discover our top product ITGB1BP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ITGB1BP3 Blocking Peptide, catalog no. 33R-10154, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))
- Andere Bezeichnung
- ITGB1BP3 (ITGB1BP3 Produkte)
- Synonyme
- ITGB1BP3 antikoerper, MIBP antikoerper, NRK2 antikoerper, itgb1bp3 antikoerper, 2310015C21Rik antikoerper, Itgb1bp3 antikoerper, Mibp antikoerper, zgc:103408 antikoerper, nicotinamide riboside kinase 2 antikoerper, integrin beta 1 binding protein 3 antikoerper, nicotinamide riboside kinase 2 S homeolog antikoerper, NMRK2 antikoerper, ITGB1BP3 antikoerper, nmrk2.S antikoerper, nmrk2 antikoerper, Nmrk2 antikoerper
- Hintergrund
- ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).
- Molekulargewicht
- 26 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-