ITGB1BP3 Antikörper (Middle Region)

Produktnummer ABIN630714

Produktdetails anti-ITGB1BP3 Antikörper

Target: ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITGB1BP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ITGB1 BP3 antibody was raised against the middle region of ITGB1 P3

Aufreinigung: Affinity purified

Immunogen: ITGB1 BP3 antibody was raised using the middle region of ITGB1 P3 corresponding to a region with amino acids YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ITGB1BP3 Blocking Peptide, catalog no. 33R-10154, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITGB1BP3

Target: ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))

Andere Bezeichnung: ITGB1BP3 (ITGB1BP3 Produkte)

Synonyme: ITGB1BP3 antikoerper, MIBP antikoerper, NRK2 antikoerper, itgb1bp3 antikoerper, 2310015C21Rik antikoerper, Itgb1bp3 antikoerper, Mibp antikoerper, zgc:103408 antikoerper, nicotinamide riboside kinase 2 antikoerper, integrin beta 1 binding protein 3 antikoerper, nicotinamide riboside kinase 2 S homeolog antikoerper, NMRK2 antikoerper, ITGB1BP3 antikoerper, nmrk2.S antikoerper, nmrk2 antikoerper, Nmrk2 antikoerper

Hintergrund: ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development