IMPDH2 Antikörper

Produktnummer ABIN630710

Produktdetails anti-IMPDH2 Antikörper

Target: IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IMPDH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: IMPDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IMPDH2 Blocking Peptide, catalog no. 33R-8336, is also available for use as a blocking control in assays to test for specificity of this IMPDH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IMPDH2

Target: IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))

Andere Bezeichnung: IMPDH2 (IMPDH2 Produkte)

Synonyme: imp2 antikoerper, impd2 antikoerper, impdh-ii antikoerper, impdh2 antikoerper, IMPD2 antikoerper, IMPDH-II antikoerper, IMPD 2 antikoerper, IMPDH 2 antikoerper, cb635 antikoerper, wu:fb64g02 antikoerper, wu:fc43f09 antikoerper, IMPD antikoerper, inosine monophosphate dehydrogenase 2 antikoerper, IMP (inosine 5'-monophosphate) dehydrogenase 2 antikoerper, inosine 5'-phosphate dehydrogenase 2 antikoerper, IMPDH2 antikoerper, impdh2.S antikoerper, impdh2 antikoerper, Impdh2 antikoerper

Hintergrund: IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interaktom